Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8K1 (OR8K1)

This Recombinant Human Olfactory receptor 8K1 (OR8K1) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 8K1, Olfactory receptor OR11-182

UniProt

Q8NGG5

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHVVKHNHTAVTKVTEFILMGITDNPGLQAPLFGLFLIIYLVTVIGNLGMVILTYLDSK LHTPMYFFLRHLSITDLGYSTVIAPKMLVNFIVHKNTISYNWYATQLAFFEIFIISELFI LSAMAYDRYVAICKPLLYVIIMAEKVLWVLVIVPYLYSTFVSLFLTIKLFKLSFCGSNII SYFYCDCIPLMSILCSDTNELELIILIFSGCNLLFSLSIVLISYMFILVAILRMNSRKGR YKAFSTCSSHLTVVIMFYGTLLFIYLQPKSSHTLAIDKMASVFYTLLIPMLNPLIYSLRN KEVKDALKRTLTNRFKIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tricosanoic Acid
MBS392196-01 100 mg

Tricosanoic Acid

Sign In for Pricing
View Details
Tricosanoic Acid
MBS392196-02 500 mg

Tricosanoic Acid

Sign In for Pricing
View Details
Tricosanoic Acid
MBS392196-03 1 g

Tricosanoic Acid

Sign In for Pricing
View Details
Tricosanoic Acid
MBS392196-04 5x 1 g

Tricosanoic Acid

Sign In for Pricing
View Details
PKM2 inhibitor G
T67900-01 1 mg

PKM2 inhibitor G

Sign In for Pricing
View Details
PKM2 inhibitor G
T67900-02 1 mL - 10 mM (in DMSO)

PKM2 inhibitor G

Sign In for Pricing
View Details