Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8K1 (OR8K1)

This Recombinant Human Olfactory receptor 8K1 (OR8K1) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 8K1, Olfactory receptor OR11-182

UniProt

Q8NGG5

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHVVKHNHTAVTKVTEFILMGITDNPGLQAPLFGLFLIIYLVTVIGNLGMVILTYLDSK LHTPMYFFLRHLSITDLGYSTVIAPKMLVNFIVHKNTISYNWYATQLAFFEIFIISELFI LSAMAYDRYVAICKPLLYVIIMAEKVLWVLVIVPYLYSTFVSLFLTIKLFKLSFCGSNII SYFYCDCIPLMSILCSDTNELELIILIFSGCNLLFSLSIVLISYMFILVAILRMNSRKGR YKAFSTCSSHLTVVIMFYGTLLFIYLQPKSSHTLAIDKMASVFYTLLIPMLNPLIYSLRN KEVKDALKRTLTNRFKIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700017B05Rik Mouse siRNA Oligo Duplex (Locus ID 74211)
SR421752 1 Kit

1700017B05Rik Mouse siRNA Oligo Duplex (Locus ID 74211)

Sign In for Pricing
View Details
IdU Mouse Monoclonal Antibody [Clone ID: LBI2B10]
AMM08863VCF 100 µg

IdU Mouse Monoclonal Antibody [Clone ID: LBI2B10]

Sign In for Pricing
View Details
Lentiviral human VPS36 sgRNA gene knockout kit - Lentiviral human VPS36 sgRNA gene knockout kit (plasmid)
GTR15365813 1 Vial

Lentiviral human VPS36 sgRNA gene knockout kit - Lentiviral human VPS36 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Plastid division protein CDP1, chloroplastic (CDP1)
orb2922652-01 20 µg

Recombinant Arabidopsis thaliana Plastid division protein CDP1, chloroplastic (CDP1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Plastid division protein CDP1, chloroplastic (CDP1)
orb2922652-02 100 µg

Recombinant Arabidopsis thaliana Plastid division protein CDP1, chloroplastic (CDP1)

Sign In for Pricing
View Details
MS4A4B siRNA (m)
sc-149649 10 µM

MS4A4B siRNA (m)

Sign In for Pricing
View Details