Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Adenosine receptor A3 (ADORA3)

This Recombinant Rabbit Adenosine receptor A3 (ADORA3) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Adenosine receptor A3

UniProt

O02667

Expression Region

1-319

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPDNSTTLFLAIRASYIVFEIVIGVCAVVGNVLVIWVIKLNPSLKTTTFYFIFSLALADI AVGFLVMPLAIVISLGITIGFYSCLVMSCLLLVFTHASIMSLLAIAVDRYLRVKLTVRYR RVTTQRRIWLALGLCWVVSLLVGFTPMFGWNMKPTLESARNYSDFQCKFDSVIPMEYMVF FSFFTWILIPLLLMCALYVYIFYIIRNKLVQSFSSFKETGAFYRREFKTAKSLFLVLALF AGCWLPLSIINCVTYFKCKVPDVVLLVGILLSHANSMMNPIVYACKIQKFKETYLLIFKA RVTCQPSDSLDPSSEQNSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2M 3'UTR GFP Stable Cell Line
TU077671 1.0 mL

UBE2M 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cytokine Vial Adapter (13 mm)
CVA-25060601-1package 1 Package

Cytokine Vial Adapter (13 mm)

Sign In for Pricing
View Details
Mercaptopurine (6-MP)
S1305-10mM/1mL 10 mM/1mL

Mercaptopurine (6-MP)

Sign In for Pricing
View Details
Xpress™ Human C2ORF15 Over-expressing Stable Cell Line
ABC-X0405 1 Vial

Xpress™ Human C2ORF15 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Inhibitor mmu-miR-7057-3p AAV miRNA Vector
Amm3166000 500 ng

Inhibitor mmu-miR-7057-3p AAV miRNA Vector

Sign In for Pricing
View Details
Cy3 Dextran (MW 3000)
orb3135666-01 50 mg

Cy3 Dextran (MW 3000)

Sign In for Pricing
View Details