Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7C2 (OR7C2)

This Recombinant Human Olfactory receptor 7C2 (OR7C2) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 7C2, Olfactory receptor 19-18, OR19-18, Olfactory receptor 7C3, Olfactory receptor OR19-22

UniProt

O60412

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERGNQTEVGNFLLLGFAEDSDMQLLLHGLFLSMYLVTIIGNLLIILTISSDSHLHTPMY FFLSNLSFADICFTSTTVPKMLVNIQTQSKMITFAGCLTQIFFFIAFGCLDNLLLTMTAY DRFVAICYPLHYTVIMNPRLCGLLVLGSWCISVMGSLLETLTILRLSFCTNMEIPHFFCD PSEVLKLACSDTFINNIVMYFVTIVLGVFPLCGILFSYSQIFSSVLRVSARGQHKAFSTC GSHLSVVSLFYGTGLGVYLSSAVTPPSRTSLAASVMYTMVTPMLNPFIYSLRNKDMKGSL GRLLLRATSLKEGTIAKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNQ5 Antibody - C-terminal region
ARP35296_P050-25UL 25 µL

KCNQ5 Antibody - C-terminal region

Sign In for Pricing
View Details
(1S,2R,3R,8S) -4-Iodocubane-1-carboxylic acid
OR312579-01 100 mg

(1S,2R,3R,8S) -4-Iodocubane-1-carboxylic acid

Sign In for Pricing
View Details
(1S,2R,3R,8S) -4-Iodocubane-1-carboxylic acid
OR312579-02 250 mg

(1S,2R,3R,8S) -4-Iodocubane-1-carboxylic acid

Sign In for Pricing
View Details
DARPP-32 (Thr75) Antibody
bs-70060R 100 µL

DARPP-32 (Thr75) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal anti-Human CD47 Antibody
xAP-0287 100 µg

Mouse Monoclonal anti-Human CD47 Antibody

Sign In for Pricing
View Details
Recombinant Bacillus anthracis UPF0756 membrane protein BAMEG_4871 (BAMEG_4871)
MBS7036578-01 0.02 mg

Recombinant Bacillus anthracis UPF0756 membrane protein BAMEG_4871 (BAMEG_4871)

Sign In for Pricing
View Details