Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7C2 (OR7C2)

This Recombinant Human Olfactory receptor 7C2 (OR7C2) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 7C2, Olfactory receptor 19-18, OR19-18, Olfactory receptor 7C3, Olfactory receptor OR19-22

UniProt

O60412

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERGNQTEVGNFLLLGFAEDSDMQLLLHGLFLSMYLVTIIGNLLIILTISSDSHLHTPMY FFLSNLSFADICFTSTTVPKMLVNIQTQSKMITFAGCLTQIFFFIAFGCLDNLLLTMTAY DRFVAICYPLHYTVIMNPRLCGLLVLGSWCISVMGSLLETLTILRLSFCTNMEIPHFFCD PSEVLKLACSDTFINNIVMYFVTIVLGVFPLCGILFSYSQIFSSVLRVSARGQHKAFSTC GSHLSVVSLFYGTGLGVYLSSAVTPPSRTSLAASVMYTMVTPMLNPFIYSLRNKDMKGSL GRLLLRATSLKEGTIAKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKL1 Rabbit pAb
E45R20762N-100 100 µL

MKL1 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Human JAK1 Protein, C-His
MBS1587448-01 0.1 mg

Recombinant Human JAK1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human JAK1 Protein, C-His
MBS1587448-02 1 mg

Recombinant Human JAK1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human JAK1 Protein, C-His
MBS1587448-03 5x 1 mg

Recombinant Human JAK1 Protein, C-His

Sign In for Pricing
View Details
CNDP2 (CN2, CPGL, PEPA, Cytosolic Non-specific Dipeptidase, CNDP Dipeptidase 2, Glutamate Carboxypeptidase-like Protein 1, Peptidase A, FLJ10830, HsT2298) (MaxLight 750) discontinued
125120-ML750 100 µL

CNDP2 (CN2, CPGL, PEPA, Cytosolic Non-specific Dipeptidase, CNDP Dipeptidase 2, Glutamate Carboxypeptidase-like Protein 1, Peptidase A, FLJ10830, HsT2298) (MaxLight 750) discontinued

Sign In for Pricing
View Details
VPS35 CRISPR Knock Out 293T Cell Line (Human)
50182141 1x 10^6 Cells / 1.0 mL

VPS35 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details