Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class XA 10 (srxa-10)

This Recombinant Serpentine receptor class XA 10 (srxa-10) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Serpentine receptor class XA 10, Protein srxa-10

UniProt

P34551

Expression Region

1-319

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVDAAVVKRIALWVYETCSVFNLFYCITLSLAIKTSKNNALPATYIYNMAISNALLVIF GIMVYILPYYMSDKTYKTYRDSIGAMISVGVTFNYLHPMLTLILMTINRIAVVVSMQASQ LFTSSKIWLYTSFHMTANFACLIIPYLSECRINYDIRKVGFISECAPDRHQITTFSNYYS VFFPFVAFFFNVLVIINFKLQRSPTYTKIKNMFRPKKKTERMLMIQAFITAFYLSVYELT SLVLRVVPELFGNLSLDGKLAFTYFRLAQVPCHVFLVYFIFTPVTRKIYMDFVRERVFCM KPAKKKTIKVSATTTSTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PRADC1/PAP21 Protein (His Tag)
PKSH032919-01 10 µg

Recombinant Human PRADC1/PAP21 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PRADC1/PAP21 Protein (His Tag)
PKSH032919-02 50 µg

Recombinant Human PRADC1/PAP21 Protein (His Tag)

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF488A conjugate, 0.1mg/mL
BNC880700-100 1x 100 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3 + A103), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KLRF1 (NM_001291822) Human Tagged ORF Clone
RG236340 10 µg

KLRF1 (NM_001291822) Human Tagged ORF Clone

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Biotin,  30nm
GAB-02-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Biotin, 30nm

Sign In for Pricing
View Details
Human FNIP1 activation kit by CRISPRa
GA114346 1 Kit

Human FNIP1 activation kit by CRISPRa

Sign In for Pricing
View Details