Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class XA 10 (srxa-10)

This Recombinant Serpentine receptor class XA 10 (srxa-10) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Serpentine receptor class XA 10, Protein srxa-10

UniProt

P34551

Expression Region

1-319

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVDAAVVKRIALWVYETCSVFNLFYCITLSLAIKTSKNNALPATYIYNMAISNALLVIF GIMVYILPYYMSDKTYKTYRDSIGAMISVGVTFNYLHPMLTLILMTINRIAVVVSMQASQ LFTSSKIWLYTSFHMTANFACLIIPYLSECRINYDIRKVGFISECAPDRHQITTFSNYYS VFFPFVAFFFNVLVIINFKLQRSPTYTKIKNMFRPKKKTERMLMIQAFITAFYLSVYELT SLVLRVVPELFGNLSLDGKLAFTYFRLAQVPCHVFLVYFIFTPVTRKIYMDFVRERVFCM KPAKKKTIKVSATTTSTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orsellinic Acid
TRC-O697608-50MG 50 mg

Orsellinic Acid

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Nucleocapsid Protein, Biotinylated (His Tag)
PKSR030512 20 µg

Recombinant SARS-CoV-2 Nucleocapsid Protein, Biotinylated (His Tag)

Sign In for Pricing
View Details
Progesterone (6-5E-3F), CF594 conjugate, 0.1mg/mL
BNC940236-500 1x 500 µL

Progesterone (6-5E-3F), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmem213 Mouse Gene Knockout Kit (CRISPR)
KN517802 1 Kit

Tmem213 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL-2, Tag Free
HA210795-01 20 µg

Human IL-2, Tag Free

Sign In for Pricing
View Details
Human IL-2, Tag Free
HA210795-02 50 µg

Human IL-2, Tag Free

Sign In for Pricing
View Details