Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsA (ccsA)

This Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsA (ccsA) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsA

UniProt

A5GLB4

Expression Region

1-320

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSFDLQSITSEPVLLLGLAAFALLLTALPWCFWAVSNGRSSSGVRSLLGLSNLLLTAQL VLRWWQSGHFPISNLYESLCFLAWACTLTQLLVERQWPSPLVAASATPMGLGCIAFASFA LPDQLQQASPLVPALRSSWLVMHVSVIMVSYAALLVGSLLSVAVLMTDRGQQLELRSSSI GSGAFRKAVSITGETSAVGVQAAPELQLSSIDFSRSEQLDSLSYRTITVGFLLLTVGIIS GAVWANEAWGSWWSWDPKETWALICWLVYAAYLHTRLSRGWQGRRPAMVASLGLVVIVVC YIGVNLLGIGLHSYGWFFDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3352), CF568 conjugate, 0.1mg/mL
BNC683352-500 1x 500 µL

Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3352), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), Biotin conjugate, 0.1mg/mL
BNCB1865-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, head
CS707034 5x 5 µm

Tissue FFPE Sections, Bone: femur, head

Sign In for Pricing
View Details
Rasd2 Mouse Gene Knockout Kit (CRISPR)
KN514496 1 Kit

Rasd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse MMP12/MMP-12/HME Protein (His Tag)
PKSM041106-01 10 µg

Recombinant Mouse MMP12/MMP-12/HME Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse MMP12/MMP-12/HME Protein (His Tag)
PKSM041106-02 50 µg

Recombinant Mouse MMP12/MMP-12/HME Protein (His Tag)

Sign In for Pricing
View Details