Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsA (ccsA)

This Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsA (ccsA) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsA

UniProt

A5GLB4

Expression Region

1-320

Origin

Synechococcus sp. (strain WH7803)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSFDLQSITSEPVLLLGLAAFALLLTALPWCFWAVSNGRSSSGVRSLLGLSNLLLTAQL VLRWWQSGHFPISNLYESLCFLAWACTLTQLLVERQWPSPLVAASATPMGLGCIAFASFA LPDQLQQASPLVPALRSSWLVMHVSVIMVSYAALLVGSLLSVAVLMTDRGQQLELRSSSI GSGAFRKAVSITGETSAVGVQAAPELQLSSIDFSRSEQLDSLSYRTITVGFLLLTVGIIS GAVWANEAWGSWWSWDPKETWALICWLVYAAYLHTRLSRGWQGRRPAMVASLGLVVIVVC YIGVNLLGIGLHSYGWFFDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C16orf57 (USB1) activation kit by CRISPRa
GA112519 1 Kit

Human C16orf57 (USB1) activation kit by CRISPRa

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF488A conjugate, 0.1mg/mL
BNC881148-500 1x 500 µL

CD45RA (PTPRC/1148), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CLUAP1 Polyclonal Antibody
E-AB-11090-01 20 µL

CLUAP1 Polyclonal Antibody

Sign In for Pricing
View Details
CLUAP1 Polyclonal Antibody
E-AB-11090-02 60 µL

CLUAP1 Polyclonal Antibody

Sign In for Pricing
View Details
CLUAP1 Polyclonal Antibody
E-AB-11090-03 120 µL

CLUAP1 Polyclonal Antibody

Sign In for Pricing
View Details
CLUAP1 Polyclonal Antibody
E-AB-11090-04 200 µL

CLUAP1 Polyclonal Antibody

Sign In for Pricing
View Details