Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-28 (srd-28)

This Recombinant Serpentine receptor class delta-28 (srd-28) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-28, Protein srd-28

UniProt

O17956

Expression Region

1-320

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYQLLHTVLSVVGVSLNAFMMYLALTKSPKIMLPCSAIITIKTFTDILTSAMSFFVMQR IVTDGSSILVIPTGPCTHLGPTACYIGHMFMLCFLECNLIWMISSYIFRYYILYVRDPSI KSLVFVAICLSIPSFIHMATWISNYDPTVAIAIPENVGIESRDMVLGGTIVTWSALTLII QLFITSILVLIAYAWIRNTLLSFAVKMGSDKNDVKKLNTRLVKVINFQVFLPSFIFLGVF VFVGMFTQLIDPKISQYLVSVIFMFSPICSPFSYILFVPHYLNVILGNKKVSEAKSTTEG CTFRHVNMAASTSNTPECSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR6 (PARD6A) Rabbit Polyclonal Antibody
TA368866 100 µL

PAR6 (PARD6A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM38A (PIEZO1) Human Gene Knockout Kit (CRISPR)
KN427972 1 Kit

FAM38A (PIEZO1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Malignant T cell amplified sequence 1 (MCTS1) activation kit by CRISPRa
GA109190 1 Kit

Human Malignant T cell amplified sequence 1 (MCTS1) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Breast, left
CR559617 5 µg

Tissue Total RNA, Breast, left

Sign In for Pricing
View Details
BrdU (Bromodeoxyuridine) (MoBu-1), 0.2mg/mL
BNUB0884-500 1x 500 µL

BrdU (Bromodeoxyuridine) (MoBu-1), 0.2mg/mL

Sign In for Pricing
View Details
3-((2S,4S)-4-Mercaptopyrrolidine-2-carboxamido)benzoic Acid Hydrochloride
TRC-M257100-1G 1 g

3-((2S,4S)-4-Mercaptopyrrolidine-2-carboxamido)benzoic Acid Hydrochloride

Sign In for Pricing
View Details