Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-28 (srd-28)

This Recombinant Serpentine receptor class delta-28 (srd-28) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-28, Protein srd-28

UniProt

O17956

Expression Region

1-320

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYQLLHTVLSVVGVSLNAFMMYLALTKSPKIMLPCSAIITIKTFTDILTSAMSFFVMQR IVTDGSSILVIPTGPCTHLGPTACYIGHMFMLCFLECNLIWMISSYIFRYYILYVRDPSI KSLVFVAICLSIPSFIHMATWISNYDPTVAIAIPENVGIESRDMVLGGTIVTWSALTLII QLFITSILVLIAYAWIRNTLLSFAVKMGSDKNDVKKLNTRLVKVINFQVFLPSFIFLGVF VFVGMFTQLIDPKISQYLVSVIFMFSPICSPFSYILFVPHYLNVILGNKKVSEAKSTTEG CTFRHVNMAASTSNTPECSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gremlin 1 (GREM1) Rabbit Polyclonal Antibody
AP26028PU-N 100 µg

Gremlin 1 (GREM1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHCHD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9E6]
TA502422BM 100 µL

CHCHD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9E6]

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF594 conjugate, 0.1mg/mL
BNC941461-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GATA4 Rabbit Polyclonal Antibody
AP20302PU-N 100 µg

GATA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tbc1d32 Mouse Gene Knockout Kit (CRISPR)
KN517255 1 Kit

Tbc1d32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: rectosigmoid
CS638185 5x 5 µm

Frozen Tissue Sections, Colon: rectosigmoid

Sign In for Pricing
View Details