Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-40 (srd-40)

This Recombinant Serpentine receptor class delta-40 (srd-40) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-40, Protein srd-40

UniProt

Q19509

Expression Region

1-320

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGADIYRDVLYIFYPIFFIFSTITQLMLIYLIFYHSPTHLKMLKVFLLNTSLFQIILVVV SCSSQFRMITTAIPIELRSYGLLRYLEAWLGYTMYQVLQTSAFMSGMSILITFVFKYELV RQIEFSKSRVTGIILLFHMPIIASMVMEVIMVINQSLPNEIREQYKFLNANAEEYSIVGA LSLKTVPSLINFLLISGSVVASPFISFFFREKILRRINSQFYQHSKWKKSQIQVFVKGLT IQAFLPLIFYVPVFGLYFYCILTHTEILFQQYFMTVVPCLPAFFDPMLTLYFVTPYRRRL KIWMRIEKESKVLPVTSLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TRIM34A shRNA Plasmid
abx979275-01 150 µg

Mouse TRIM34A shRNA Plasmid

Sign In for Pricing
View Details
Mouse TRIM34A shRNA Plasmid
abx979275-02 300 µg

Mouse TRIM34A shRNA Plasmid

Sign In for Pricing
View Details
Porcine E3 Ubiquitin-Protein Ligase Synoviolin (SYVN1) ELISA Kit
MBS9919728-01 48 Well

Porcine E3 Ubiquitin-Protein Ligase Synoviolin (SYVN1) ELISA Kit

Sign In for Pricing
View Details
Porcine E3 Ubiquitin-Protein Ligase Synoviolin (SYVN1) ELISA Kit
MBS9919728-02 96 Well

Porcine E3 Ubiquitin-Protein Ligase Synoviolin (SYVN1) ELISA Kit

Sign In for Pricing
View Details
Porcine E3 Ubiquitin-Protein Ligase Synoviolin (SYVN1) ELISA Kit
MBS9919728-03 5x 96 Well

Porcine E3 Ubiquitin-Protein Ligase Synoviolin (SYVN1) ELISA Kit

Sign In for Pricing
View Details
Porcine E3 Ubiquitin-Protein Ligase Synoviolin (SYVN1) ELISA Kit
MBS9919728-04 10x 96 Well

Porcine E3 Ubiquitin-Protein Ligase Synoviolin (SYVN1) ELISA Kit

Sign In for Pricing
View Details