Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-40 (srd-40)

This Recombinant Serpentine receptor class delta-40 (srd-40) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-40, Protein srd-40

UniProt

Q19509

Expression Region

1-320

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGADIYRDVLYIFYPIFFIFSTITQLMLIYLIFYHSPTHLKMLKVFLLNTSLFQIILVVV SCSSQFRMITTAIPIELRSYGLLRYLEAWLGYTMYQVLQTSAFMSGMSILITFVFKYELV RQIEFSKSRVTGIILLFHMPIIASMVMEVIMVINQSLPNEIREQYKFLNANAEEYSIVGA LSLKTVPSLINFLLISGSVVASPFISFFFREKILRRINSQFYQHSKWKKSQIQVFVKGLT IQAFLPLIFYVPVFGLYFYCILTHTEILFQQYFMTVVPCLPAFFDPMLTLYFVTPYRRRL KIWMRIEKESKVLPVTSLVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Goat anti-Armenian Hamster IgG (H+L) Secondary Antibody [DyLight 650]
NB120-5738C 0.5 mL

Goat Polyclonal Goat anti-Armenian Hamster IgG (H+L) Secondary Antibody [DyLight 650]

Sign In for Pricing
View Details
1- (5-ethyl-2-methoxyphenyl) -2,2-dimethylpropan-1-ol
OR1091572-01 250 mg

1- (5-ethyl-2-methoxyphenyl) -2,2-dimethylpropan-1-ol

Sign In for Pricing
View Details
1- (5-ethyl-2-methoxyphenyl) -2,2-dimethylpropan-1-ol
OR1091572-02 500 mg

1- (5-ethyl-2-methoxyphenyl) -2,2-dimethylpropan-1-ol

Sign In for Pricing
View Details
1- (5-ethyl-2-methoxyphenyl) -2,2-dimethylpropan-1-ol
OR1091572-03 1 g

1- (5-ethyl-2-methoxyphenyl) -2,2-dimethylpropan-1-ol

Sign In for Pricing
View Details
PIM1 Recombinant Protein
OPCD06186-50UG 50 µg

PIM1 Recombinant Protein

Sign In for Pricing
View Details
RP2 Mouse Monoclonal Antibody (APC)
orb2608229 100 µg

RP2 Mouse Monoclonal Antibody (APC)

Sign In for Pricing
View Details