Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0678 (MJ0678)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0678 (MJ0678) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0678

UniProt

Q58091

Expression Region

1-320

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLRFIECHIPKHLFMGIDEIREWDGVIWANVKTNGTISTIQILTTLKDSEKIVDKLKEM YGGANYRVVVFEPTMTYPPIEEEEEKEEPERLIREELYNIASDIANLSKENMLMLILSTI VAIAGIYKDDVALLIASMIIAPLLGPNIALSLSITVADYKLALKSIKTLIAELIFVIILS MIAGHYLPISLDNPQIHSRITLDFWSIIIALSAGIAGSLSTVSNISSIAVGVMIAIALLP PLAVFGLLIGAGYVEQSFSALILFLINMIAINLSAIVIFSAYGISPYRWWKKEEARKYTL YAILLWVTLFIAIFVLIIYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-3178 mimic
HY-R00635-01 5 nmol

Hsa-miR-3178 mimic

Sign In for Pricing
View Details
Hsa-miR-3178 mimic
HY-R00635-02 20 nmol

Hsa-miR-3178 mimic

Sign In for Pricing
View Details
GPNMB Conjugated Antibody
MBS9456404-01 0.1 mL (Biotin)

GPNMB Conjugated Antibody

Sign In for Pricing
View Details
GPNMB Conjugated Antibody
MBS9456404-02 0.1 mL (AF350)

GPNMB Conjugated Antibody

Sign In for Pricing
View Details
GPNMB Conjugated Antibody
MBS9456404-03 0.1 mL (AF405)

GPNMB Conjugated Antibody

Sign In for Pricing
View Details
GPNMB Conjugated Antibody
MBS9456404-04 0.1 mL (AF488)

GPNMB Conjugated Antibody

Sign In for Pricing
View Details