Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 109 (Tas2r109)

This Recombinant Rat Taste receptor type 2 member 109 (Tas2r109) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 109, T2R109, Taste receptor type 2 member 38, T2R38

UniProt

Q675B9

Expression Region

1-320

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHFLKSIFDISKNVLPIILFIELIIGIIGNGFMALVHCMDWVKRKKMSLVNQILTTLAT SRICLLWFMLLGLLITLLDPDLASARMMIQVASNLWIIANHMSIWLATCLTVFYFLKIAN FSSSLFLYLKWRVEKVISVIFLVSLVLLFLNMLLMNLENDMCIAEYHQINISYSFIYHYR ADCERRVLRLHIIILSVPFVLSLPTFLLLIFSLWTHHKKMQQHVQGRRDASTTAHFKALQ TVIAFLLLYCIFILSMLLQFWKYELMKKPLFILFCHIVYGAFPSFHSYVLILGDMKLRQA SLSVLLWLKCRPNYIETLDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), CF647 conjugate, 0.1mg/mL
BNC472029-100 1x 100 µL

ARF1 (Golgi Apparatus Marker) (3F1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, MT (TOP1MT/488), CF647 conjugate, 0.1mg/mL
BNC470488-100 1x 100 µL

Topoisomerase I, MT (TOP1MT/488), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF640R conjugate, 0.1mg/mL
BNC402340-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF405S conjugate, 0.1mg/mL
BNC041857-100 1x 100 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details