Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 129 (Tas2r129)

This Recombinant Mouse Taste receptor type 2 member 129 (Tas2r129) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 129, T2R129, mT2R60

UniProt

Q7M709

Expression Region

1-320

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGIVQNMFTFIVIVEIIIGWIGNGFIALVNCIHWYKRRKISALNQILTALAFSRIYLLL TVFTVIAVSTLYTHVLVTRRVVKLINFHLLFSNHFSMWLAACLGLYYFLKIAHFPNSIFV YLKMRINQVVSGTLLMSLGLLFLNTLLINSYIDTKIDDYREHLLYDFTSNNTASFYRVIL VINNCIFTSIPFTLSQSTFLLLIFSLWRHYKKMQQHAQRCRDVLADAHIRVLQTMVTYVL LCAIFFLSLSMQILRSELLKNILYVRFCEIVAAVFPSGHSCVLICRDTNLRGTFLSVLSW LKQRFTSWIPNINCRSSCIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas Aeruginosa mnmA Protein (aa 1-375) (strain PA7)
VAng-Cr0553-1mgEcoli 1 mg (E. coli)

Recombinant Pseudomonas Aeruginosa mnmA Protein (aa 1-375) (strain PA7)

Sign In for Pricing
View Details
GLUT4 (SLC2A4) (C-term) rabbit polyclonal antibody, Purified
BP508 100 µL

GLUT4 (SLC2A4) (C-term) rabbit polyclonal antibody, Purified

Sign In for Pricing
View Details
CCR4 siRNA Oligos set (Human)
15428171 3x 5 nmol

CCR4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cubilin (CUBN)
MBS2094487-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Cubilin (CUBN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cubilin (CUBN)
MBS2094487-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Cubilin (CUBN)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cubilin (CUBN)
MBS2094487-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Cubilin (CUBN)

Sign In for Pricing
View Details