Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 129 (Tas2r129)

This Recombinant Mouse Taste receptor type 2 member 129 (Tas2r129) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 129, T2R129, mT2R60

UniProt

Q7M709

Expression Region

1-320

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGIVQNMFTFIVIVEIIIGWIGNGFIALVNCIHWYKRRKISALNQILTALAFSRIYLLL TVFTVIAVSTLYTHVLVTRRVVKLINFHLLFSNHFSMWLAACLGLYYFLKIAHFPNSIFV YLKMRINQVVSGTLLMSLGLLFLNTLLINSYIDTKIDDYREHLLYDFTSNNTASFYRVIL VINNCIFTSIPFTLSQSTFLLLIFSLWRHYKKMQQHAQRCRDVLADAHIRVLQTMVTYVL LCAIFFLSLSMQILRSELLKNILYVRFCEIVAAVFPSGHSCVLICRDTNLRGTFLSVLSW LKQRFTSWIPNINCRSSCIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Neutrophil Elastase/ELA2 Antibody (950317) [DyLight 350]
FAB91671D 0.1 mL

Mouse Monoclonal Neutrophil Elastase/ELA2 Antibody (950317) [DyLight 350]

Sign In for Pricing
View Details
Goat Cell division cycle protein 27 homolog (CDC27) ELISA Kit
MBS7216952-01 48 Well

Goat Cell division cycle protein 27 homolog (CDC27) ELISA Kit

Sign In for Pricing
View Details
Goat Cell division cycle protein 27 homolog (CDC27) ELISA Kit
MBS7216952-02 96 Well

Goat Cell division cycle protein 27 homolog (CDC27) ELISA Kit

Sign In for Pricing
View Details
Goat Cell division cycle protein 27 homolog (CDC27) ELISA Kit
MBS7216952-03 5x 96 Well

Goat Cell division cycle protein 27 homolog (CDC27) ELISA Kit

Sign In for Pricing
View Details
Goat Cell division cycle protein 27 homolog (CDC27) ELISA Kit
MBS7216952-04 10x 96 Well

Goat Cell division cycle protein 27 homolog (CDC27) ELISA Kit

Sign In for Pricing
View Details
Anti-Cyclin D1 PE
1P-166-C100 0.1 mg

Anti-Cyclin D1 PE

Sign In for Pricing
View Details