Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5C1 (OR5C1)

This Recombinant Human Olfactory receptor 5C1 (OR5C1) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 5C1, Olfactory receptor 5C2, Olfactory receptor 9-F, OR9-F

UniProt

Q8NGR4

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSENLTRAAVAPAEFVLLGITNRWDLRVALFLTCLPVYLVSLLGNMGMALLIRMDARLH TPMYFFLANLSLLDACYSSAIGPKMLVDLLLPRATIPYTACALQMFVFAGLADTECCLLA AMAYDRYVAIRNPLLYTTAMSQRLCLALLGASGLGGAVSAFVHTTLTFRLSFCRSRKINS FFCDIPPLLAISCSDTSLNELLLFAICGFIQTATVLAITVSYGFIAGAVIHMRSVEGSRR AASTGGSHLTAVAMMYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKE VKEALRQTWSRFHCPGQGSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Igk (Immunoglobulin Kappa) Microsample ELISA Kit
ELK5262MS-01 48 Tests

Human Igk (Immunoglobulin Kappa) Microsample ELISA Kit

Sign In for Pricing
View Details
Human Igk (Immunoglobulin Kappa) Microsample ELISA Kit
ELK5262MS-02 96 Tests

Human Igk (Immunoglobulin Kappa) Microsample ELISA Kit

Sign In for Pricing
View Details
Human Igk (Immunoglobulin Kappa) Microsample ELISA Kit
ELK5262MS-03 5x 96 Tests

Human Igk (Immunoglobulin Kappa) Microsample ELISA Kit

Sign In for Pricing
View Details
Iqch sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4037706 1.0 µg DNA

Iqch sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human C3orf10 (BRK1) (NM_018462) AAV Particle
RC200804A1V 250 µL

Human C3orf10 (BRK1) (NM_018462) AAV Particle

Sign In for Pricing
View Details
Anti-TORC1/CRTC1 Antibody Picoband®, Dylight594 Conjugate
A01951-2-Dylight594 100 µg

Anti-TORC1/CRTC1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details