Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5C1 (OR5C1)

This Recombinant Human Olfactory receptor 5C1 (OR5C1) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 5C1, Olfactory receptor 5C2, Olfactory receptor 9-F, OR9-F

UniProt

Q8NGR4

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSENLTRAAVAPAEFVLLGITNRWDLRVALFLTCLPVYLVSLLGNMGMALLIRMDARLH TPMYFFLANLSLLDACYSSAIGPKMLVDLLLPRATIPYTACALQMFVFAGLADTECCLLA AMAYDRYVAIRNPLLYTTAMSQRLCLALLGASGLGGAVSAFVHTTLTFRLSFCRSRKINS FFCDIPPLLAISCSDTSLNELLLFAICGFIQTATVLAITVSYGFIAGAVIHMRSVEGSRR AASTGGSHLTAVAMMYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKE VKEALRQTWSRFHCPGQGSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL6IP1P1 Protein Vector (Human) (pPM-C-His)
PV063196 500 ng

ARL6IP1P1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Calponin 1 antibody
orb2276530-01 0.1 mL

Calponin 1 antibody

Sign In for Pricing
View Details
Calponin 1 antibody
orb2276530-02 0.5 mL

Calponin 1 antibody

Sign In for Pricing
View Details
Calponin 1 antibody
orb2276530-03 1 mL

Calponin 1 antibody

Sign In for Pricing
View Details
LRCH3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-9329R-BF488 100 µL

LRCH3 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Adrenergic Receptor, beta 2 (Beta-2 Adrenergic Receptor, Beta-2 Adrenoreceptor, Beta-2 Adrenoceptor, ADRB2, ADRB2R, B2AR)
A0906-89 100 µg

Adrenergic Receptor, beta 2 (Beta-2 Adrenergic Receptor, Beta-2 Adrenoreceptor, Beta-2 Adrenoceptor, ADRB2, ADRB2R, B2AR)

Sign In for Pricing
View Details