Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T12 (OR2T12)

This Recombinant Human Olfactory receptor 2T12 (OR2T12) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 2T12, Olfactory receptor OR1-57

UniProt

Q8NG77

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEMRNTTPDFILLGLFNHTRAHQVLFMMLLATVLTSLFSNALMILLIHWDHRLHRPMYFL LSQLSLMDMMLVSTTVPKMAADYLTGNKAISRAGCGVQIFFLPTLGGGECFLLAAMAYDR YAAVCHPLRYPTLMSWQLCLRMTMSSWLLGAADGLLQAVATLSFPYCGAHEIDHFFCEAP VLVRLACADTSVFENAMYICCVLMLLVPFSLILSSYGLILAAVLLMRSTEARKKAFATCS SHVAVVGLFYGAGIFTYMRPKSHRSTNHDKVVSAFYTMFTPLLNPLIYSVRNSEVKEALK RWLGTCVNLKHQQNEAHRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THEM5 Human Gene Knockout Kit (CRISPR)
KN410954 1 Kit

THEM5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Goat anti-AVPR2 Antibody
dAP-1534 50 µg

Goat anti-AVPR2 Antibody

Sign In for Pricing
View Details
Recombinant Pongo abelii Transmembrane protein 234 (TMEM234)
orb2930832-01 20 µg

Recombinant Pongo abelii Transmembrane protein 234 (TMEM234)

Sign In for Pricing
View Details
Recombinant Pongo abelii Transmembrane protein 234 (TMEM234)
orb2930832-02 100 µg

Recombinant Pongo abelii Transmembrane protein 234 (TMEM234)

Sign In for Pricing
View Details
Amyloid β-Protein (Human, 1-42) (Scrambled)
4514-s 0.1 mg

Amyloid β-Protein (Human, 1-42) (Scrambled)

Sign In for Pricing
View Details
Olr559 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV635494 1.0 µg DNA

Olr559 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details