Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Glucose-6-phosphate/phosphate translocator 2, chloroplastic (GPT2)

This Recombinant Arabidopsis thaliana Glucose-6-phosphate/phosphate translocator 2, chloroplastic (GPT2) spans the amino acid sequence from region 69-388.

Product Specifications

Product Name Alternative

Glucose-6-phosphate/phosphate translocator 2, chloroplastic

UniProt

Q94B38

Expression Region

69-388

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VEAYEADRSRPLDINIELPDEQSAQKLKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLT STLSLACGSLMMLVSWATRIADAPKTDLEFWKTLFPVAVAHTIGHVAATVSMSKVAVSFT HIIKSGEPAFSVLVSRFFMGETFPLPVYLSLLPIIGGCALAAITELNFNITGFMGAMISN LAFVFRNIFSKKGMKGKSVSGMNYYACLSMMSLVILTPFSIAVEGPQMWAAGWQNAVSQV GPNFVWWVVAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIVASIIIFHTPIQPV NALGAAIAIFGTFLYSQAKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epha7 (NM_134331) Rat Tagged ORF Clone
RR212203 10 µg

Epha7 (NM_134331) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Sultiame 10mg
A19218-10 10 mg

Sultiame 10mg

Sign In for Pricing
View Details
Myosin-3 Rabbit pAb, PE-Cy5 conjugated
orb2849883 100 µL

Myosin-3 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
FCN2 Blocking Peptide
33R-7922 100 ug

FCN2 Blocking Peptide

Sign In for Pricing
View Details
Med12l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3171208 1.0 µg DNA

Med12l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
GPRC5A Antibody
MBS9606600-01 0.1 mL

GPRC5A Antibody

Sign In for Pricing
View Details