Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2C3 (OR2C3)

This Recombinant Human Olfactory receptor 2C3 (OR2C3) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30

UniProt

Q8N628

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMEIANVSSPEVFVLLGFSTRPSLETVLFIVVLSFYMVSILGNGIIILVSHTDVHLHTPM YFFLANLPFLDMSFTTSIVPQLLANLWGPQKTISYGGCVVQFYISHWLGATECVLLATMS YDRYAAICRPLHYTVIMHPQLCLGLALASWLGGLTTSMVGSTLTMLLPLCGNNCIDHFFC EMPLIMQLACVDTSLNEMEMYLASFVFVVLPLGLILVSYGHIARAVLKIRSAEGRRKAFN TCSSHVAVVSLFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKS ALRHMVLENCCGSAGKLAQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LBP-9 CRISPR/Cas9 KO Plasmid (h)
sc-404224 20 µg

LBP-9 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor 9/FGF-9
C198-500ug 500 µg

Recombinant Human Fibroblast Growth Factor 9/FGF-9

Sign In for Pricing
View Details
Anti-Ataxin 1 Antibody Picoband® (monoclonal, 2B13G8) Fluoro594 Conjugated
M01786-1-Fluoro594 100 µg/Vial

Anti-Ataxin 1 Antibody Picoband® (monoclonal, 2B13G8) Fluoro594 Conjugated

Sign In for Pricing
View Details
HOMER1 Peptide
orb2017805 100 µg

HOMER1 Peptide

Sign In for Pricing
View Details
GENLISA™ Rat GATA Binding Protein 4 (GATA4) ELISA
KLR0061 1x 96 Well

GENLISA™ Rat GATA Binding Protein 4 (GATA4) ELISA

Sign In for Pricing
View Details
Anti-TMEM213 Rabbit pAb
GB113359-50 50 μL

Anti-TMEM213 Rabbit pAb

Sign In for Pricing
View Details