Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2C3 (OR2C3)

This Recombinant Human Olfactory receptor 2C3 (OR2C3) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30

UniProt

Q8N628

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMEIANVSSPEVFVLLGFSTRPSLETVLFIVVLSFYMVSILGNGIIILVSHTDVHLHTPM YFFLANLPFLDMSFTTSIVPQLLANLWGPQKTISYGGCVVQFYISHWLGATECVLLATMS YDRYAAICRPLHYTVIMHPQLCLGLALASWLGGLTTSMVGSTLTMLLPLCGNNCIDHFFC EMPLIMQLACVDTSLNEMEMYLASFVFVVLPLGLILVSYGHIARAVLKIRSAEGRRKAFN TCSSHVAVVSLFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKS ALRHMVLENCCGSAGKLAQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEY2 (NM_012259) Human Recombinant Protein
PH40809M5 20 µg

HEY2 (NM_012259) Human Recombinant Protein

Sign In for Pricing
View Details
Olfr1122 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
32598154 3x 1.0 µg DNA

Olfr1122 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ATF4C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0140705 3x 1.0 µg

ATF4C sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rbfox2 (NM_001110828) Mouse Recombinant Protein
PM43314M5 20 µg

Rbfox2 (NM_001110828) Mouse Recombinant Protein

Sign In for Pricing
View Details
TGF beta 3 propeptide Rabbit Polyclonal Antibody (BF350)
orb1577014 100 µL

TGF beta 3 propeptide Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Gag-pol Antibody (CF488)
orb3073837 0.5 mL

Gag-pol Antibody (CF488)

Sign In for Pricing
View Details