Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 13C8 (OR13C8)

This Recombinant Human Olfactory receptor 13C8 (OR13C8) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 13C8

UniProt

Q8NGS7

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERTNDSTSTEFFLVGLSAHPKLQTVFFVLILWMYLMILLGNGVLISVIIFDSHLHTPMY FFLCNLSFLDVCYTSSSVPLILASFLAVKKKVSFSGCMVQMFISFAMGATECMILGTMAL DRYVAICYPLRYPVIMSKGAYVAMAAGSWVTGLVDSVVQTAFAMQLPFCANNVIKHFVCE ILAILKLACADISINVISMTGSNLIVLVIPLLVISISYIFIVATILRIPSTEGKHKAFST CSAHLTVVIIFYGTIFFMYAKPESKASVDSGNEDIIEALISLFYGVMTPMLNPLIYSLRN KDVKAAVKNILCRKNFSDGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B) (Active)
AP73641 Inquire

Recombinant Human Tumor necrosis factor receptor superfamily member 11B protein (TNFRSF11B) (Active)

Sign In for Pricing
View Details
EmL3 Human siRNA Oligo Duplex (Locus ID 256364)
SR316862 1 Kit

EmL3 Human siRNA Oligo Duplex (Locus ID 256364)

Sign In for Pricing
View Details
MEK5 Conjugated Antibody
MBS9456832-01 0.1 mL (Biotin)

MEK5 Conjugated Antibody

Sign In for Pricing
View Details
MEK5 Conjugated Antibody
MBS9456832-02 0.1 mL (AF350)

MEK5 Conjugated Antibody

Sign In for Pricing
View Details
MEK5 Conjugated Antibody
MBS9456832-03 0.1 mL (AF405)

MEK5 Conjugated Antibody

Sign In for Pricing
View Details
MEK5 Conjugated Antibody
MBS9456832-04 0.1 mL (AF488)

MEK5 Conjugated Antibody

Sign In for Pricing
View Details