Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51E2 (OR51E2)

This Recombinant Human Olfactory receptor 51E2 (OR51E2) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 51E2, HPRAJ, Olfactory receptor OR11-16, Prostate-specific G-protein coupled receptor

UniProt

Q9H255

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYL FLCMLAAIDLALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFD RYVAICHPLRHAAVLNNTVTAQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH QDVMKLAYADTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC VSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRT RVLAMFKISCDKDLQAVGGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse VEGF-A/VEGF164 Protein
PKSM041180-01 10 µg

Recombinant Mouse VEGF-A/VEGF164 Protein

Sign In for Pricing
View Details
Recombinant Mouse VEGF-A/VEGF164 Protein
PKSM041180-02 50 µg

Recombinant Mouse VEGF-A/VEGF164 Protein

Sign In for Pricing
View Details
PPM1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]
TA502811AM 100 µL

PPM1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H5]

Sign In for Pricing
View Details
NIPAL4 (NM_001099287) Human Over-expression Lysate
LY420426 100 µg

NIPAL4 (NM_001099287) Human Over-expression Lysate

Sign In for Pricing
View Details
HNF1A (Pancreatic Tumor Suppressor) (HNF1A/2087), 1mg/mL
BNUM2087-50 1x 50 µL

HNF1A (Pancreatic Tumor Suppressor) (HNF1A/2087), 1mg/mL

Sign In for Pricing
View Details
Human Microtubule Associated Protein Tau (MAPt) ELISA Kit
RDR-MAPt-Hu-01 96 Tests

Human Microtubule Associated Protein Tau (MAPt) ELISA Kit

Sign In for Pricing
View Details