Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2W1 (OR2W1)

This Recombinant Human Olfactory receptor 2W1 (OR2W1) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 2W1, Hs6M1-15, Olfactory receptor OR6-13

UniProt

Q9Y3N9

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITLVGNTAIILASLLDSQLHTPMY FFLRNLSFLDLCFTTSIIPQMLVNLWGPDKTISYVGCIIQLYVYMWLGSVECLLLAVMSY DRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANSVVLCTLTLNLPTCGNNILDHFLCE LPALVKIACVDTTTVEMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKAMNT CGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKDMKDA LKKLMRFHHKSTKIKRNCKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-Leu-Gly-Arg-AMC
BA9292-10 10 mg

Boc-Leu-Gly-Arg-AMC

Sign In for Pricing
View Details
Mouse Monoclonal MAGEA4 Antibody (OTI2C1) [CoraFluor 1]
NBP2-72571CL1 0.1 mL

Mouse Monoclonal MAGEA4 Antibody (OTI2C1) [CoraFluor 1]

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Putative potassium channel KAT5 (Os04g0117500, LOC_Os04g02720), partial
MBS7091248 Inquire

Recombinant Oryza sativa subsp. japonica Putative potassium channel KAT5 (Os04g0117500, LOC_Os04g02720), partial

Sign In for Pricing
View Details
Cspp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4717807 1.0 µg DNA

Cspp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
RBM42 ORF Vector (Human) (pORF)
ORF008655 1.0 µg DNA

RBM42 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ATP5L2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0150308 1.0 µg DNA

ATP5L2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details