Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 51E2 (Or51e2)

This Recombinant Rat Olfactory receptor 51E2 (Or51e2) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 51E2, G-protein coupled receptor RA1c, Olfactory receptor 59

UniProt

O88628

Expression Region

1-320

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSCNFTHATFMLIGIPGLEEAHFWFGFPLLSMYAVALFGNCIVVFIVRTERSLHAPMYL FLCMLAAIDLALSTSTMPKILALFWFDSREITFDACLAQMFFIHALSAIESTILLAMAFD RYVAICHPLRHAAVLNNTVTVQIGMVALVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH QDVMKLAYTDTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRAVLQLPSKSERAKAFGTC VSHIGVVLAFYVPLIGLSVVHRFGNSLDPIVHVLMGDVYLLLPPVINPIIYGAKTKQIRT RVLAMFKISCDKDIEAGGNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Utrophin (m) -PR
sc-43495-PR 10 µM - 20 µL

Utrophin (m) -PR

Sign In for Pricing
View Details
Rat Alpha (1,3) fucosyltransferase 10 (FUT10) ELISA kit
GTR10426826 96 Well

Rat Alpha (1,3) fucosyltransferase 10 (FUT10) ELISA kit

Sign In for Pricing
View Details
Platform 8x250ml Flasks for Flowgen Incu Shaker
SHA1314 1 Each

Platform 8x250ml Flasks for Flowgen Incu Shaker

Sign In for Pricing
View Details
PIRC27 Protein Vector (Human) (pPM-C-HA)
36761021 500 ng

PIRC27 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
MBNL3 (NM_001170704) Human Untagged Clone
SC328417 10 µg

MBNL3 (NM_001170704) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Reactive Exosome Marker Antibody Sampler Kit
CST 96128T 1 Kit

Mouse Reactive Exosome Marker Antibody Sampler Kit

Sign In for Pricing
View Details