Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 51E2 (Or51e2)

This Recombinant Rat Olfactory receptor 51E2 (Or51e2) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Olfactory receptor 51E2, G-protein coupled receptor RA1c, Olfactory receptor 59

UniProt

O88628

Expression Region

1-320

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSCNFTHATFMLIGIPGLEEAHFWFGFPLLSMYAVALFGNCIVVFIVRTERSLHAPMYL FLCMLAAIDLALSTSTMPKILALFWFDSREITFDACLAQMFFIHALSAIESTILLAMAFD RYVAICHPLRHAAVLNNTVTVQIGMVALVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH QDVMKLAYTDTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRAVLQLPSKSERAKAFGTC VSHIGVVLAFYVPLIGLSVVHRFGNSLDPIVHVLMGDVYLLLPPVINPIIYGAKTKQIRT RVLAMFKISCDKDIEAGGNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttc3 (NM_001108315) Rat Untagged Clone
RN214244 10 µg

Ttc3 (NM_001108315) Rat Untagged Clone

Sign In for Pricing
View Details
CDH8 Antibody (Biotin)
orb47949-01 50 µg

CDH8 Antibody (Biotin)

Sign In for Pricing
View Details
CDH8 Antibody (Biotin)
orb47949-02 100 µg

CDH8 Antibody (Biotin)

Sign In for Pricing
View Details
Bax sgRNA CRISPR Lentivector (Rat) (Target 1)
K7528102 1.0 µg DNA

Bax sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
mmu-miR-6980-3p miRNA Mimic
MBS8302064-01 5 nmol

mmu-miR-6980-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-6980-3p miRNA Mimic
MBS8302064-02 10 nmol

mmu-miR-6980-3p miRNA Mimic

Sign In for Pricing
View Details