Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Adenosine receptor A3 (Adora3)

This Recombinant Rat Adenosine receptor A3 (Adora3) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Adenosine receptor A3, TGPCR1

UniProt

P28647

Expression Region

1-320

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR ACRLCQTSDSLDSNLEQTTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UPF0464 protein C15orf44, C15orf44 ELISA Kit
MBS9339989-01 48 Well

Human UPF0464 protein C15orf44, C15orf44 ELISA Kit

Sign In for Pricing
View Details
Human UPF0464 protein C15orf44, C15orf44 ELISA Kit
MBS9339989-02 96 Well

Human UPF0464 protein C15orf44, C15orf44 ELISA Kit

Sign In for Pricing
View Details
Human UPF0464 protein C15orf44, C15orf44 ELISA Kit
MBS9339989-03 5x 96 Well

Human UPF0464 protein C15orf44, C15orf44 ELISA Kit

Sign In for Pricing
View Details
Human UPF0464 protein C15orf44, C15orf44 ELISA Kit
MBS9339989-04 10x 96 Well

Human UPF0464 protein C15orf44, C15orf44 ELISA Kit

Sign In for Pricing
View Details
SOX3 Rabbit Polyclonal Antibody (PE)
orb2611410 100 µg

SOX3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
SMCP Antibody (FITC)
orb238972-01 50 µg

SMCP Antibody (FITC)

Sign In for Pricing
View Details