Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Adenosine receptor A3 (Adora3)

This Recombinant Rat Adenosine receptor A3 (Adora3) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Adenosine receptor A3, TGPCR1

UniProt

P28647

Expression Region

1-320

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR ACRLCQTSDSLDSNLEQTTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Talin 2 ELISA Kit
MBS080977-01 48 Well

Porcine Talin 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Talin 2 ELISA Kit
MBS080977-02 96 Well

Porcine Talin 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Talin 2 ELISA Kit
MBS080977-03 5x 96 Well

Porcine Talin 2 ELISA Kit

Sign In for Pricing
View Details
Porcine Talin 2 ELISA Kit
MBS080977-04 10x 96 Well

Porcine Talin 2 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Nras shRNA (UAS) - Lentiviral mouse Nras shRNA (UAS) plasmid
GTR15226891 1 Vial

Lentiviral mouse Nras shRNA (UAS) - Lentiviral mouse Nras shRNA (UAS) plasmid

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Nucleophosmin (NPM)
MBS2067489-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Nucleophosmin (NPM)

Sign In for Pricing
View Details