Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Liriodendron tulipifera Cytochrome c biogenesis protein ccsA (ccsA)

This Recombinant Liriodendron tulipifera Cytochrome c biogenesis protein ccsA (ccsA) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccsA

UniProt

Q0G9H0

Expression Region

1-321

Origin

Liriodendron tulipifera (Tuliptree) (Tulip poplar)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIFATLEHILTHISFSIISIVITIHLVTLLVHEIVGLCDPSEKGMIAAFFCITGLLVTRW IYSRHFPLSDLYESLMFLSWSFSIIHMVPKIWNHKNDLSAITAPSAIFTQGFATSGLSTE MHQSAILVPALQSQWLMMHVSMMLLSYAALLCGSLLSVALLVITFRKNIGIVGKSNHLLI GSFSFDEIHYLNEKRNVLQNTSFLSFRNYHRYQLTQRLDYWSYRVISLGFTFLTIGILSG AVWANEAWGSYWNWDPKETWAFITWTIFAIYLHTRTNRSLQGVNSAIVASMGFLIIWICY FGVNLLGIGLHSYGSFTLTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-500 1x 500 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-100 1x 100 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details