Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 135 (Tas2r135)

This Recombinant Rat Taste receptor type 2 member 135 (Tas2r135) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 135, T2R135, T2R35, Taste receptor type 2 member 28, T2R28

UniProt

Q67ES2

Expression Region

1-321

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPIMSTGETSTAHTVLGCQITDKTVITLFVILVFSCLVAVVGNGFIIIALGMKWLLRRT LSAHNKLLISLAASRFCLQCVVIGKNIYVFLNPSSFPYNPVIQLLNLMWDFLTAATIWFC SLLGFFYCVKIATLTHPVFVWLKYRLPGWVPWMLLSAVGMSSLTSILCFIGNHMIYQNYA RRGHQPWNATGNSLRHSLEKFYFISIKIIMWTVPTVIFSIFMSLLLVSLVRHMKKTLLAL SELRDVWAQAHFKALLPLLSFIILFISCFLTLVLSSASSTPYQEFRYWMWQVVIHLCTVI HPIVILLSNPVLRVVMKRGCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-100 1x 100 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-500 1x 500 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details