Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52N4 (OR52N4)

This Recombinant Human Olfactory receptor 52N4 (OR52N4) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 52N4, Olfactory receptor OR11-64

UniProt

Q8NGI2

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTLNKTDLIPASFILNGVPGLEDTQLWISFPFCSMYVVAMVGNCGLLYLIHYEDALHKP MYYFLAMLSFTDLVMCSSTIPKALCIFWFHLKDIGFDECLVQMFFTHTFTGMESGVLMLM ALDRYVAICYPLRYSTILTNPVIAKVGTATFLRGVLLIIPFTFLTKLLPYCRGNILPHTY CDHMSVAKLSCGNVKVNAIYGLMVALLIWGFDILCITNSYTMILRAVVSLSSADARQKAF NTCTAHICAIVFSYTPAFFSFFSHRFGEHIIPPSCHIIVANIYLLLPPTMNPIVYGVKTK QIRDCVIRILSGSKDTKSYSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-) -Arctigenin
A-750-250-500mg 500 mg

(-) -Arctigenin

Sign In for Pricing
View Details
REMBRANDT® Target Unmasking Fluid (TUF)
Z000R.0025 1 Each

REMBRANDT® Target Unmasking Fluid (TUF)

Sign In for Pricing
View Details
Human cartilage glycoprotein39, HCgp-39; YKL-40 ELISA KIT
E3587Hu-01 48 Well

Human cartilage glycoprotein39, HCgp-39; YKL-40 ELISA KIT

Sign In for Pricing
View Details
Human cartilage glycoprotein39, HCgp-39; YKL-40 ELISA KIT
E3587Hu-02 96 Well

Human cartilage glycoprotein39, HCgp-39; YKL-40 ELISA KIT

Sign In for Pricing
View Details
Human cartilage glycoprotein39, HCgp-39; YKL-40 ELISA KIT
E3587Hu-03 5x 96 Tests

Human cartilage glycoprotein39, HCgp-39; YKL-40 ELISA KIT

Sign In for Pricing
View Details
Human cartilage glycoprotein39, HCgp-39; YKL-40 ELISA KIT
E3587Hu-04 10x 96 Tests

Human cartilage glycoprotein39, HCgp-39; YKL-40 ELISA KIT

Sign In for Pricing
View Details