Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52N4 (OR52N4)

This Recombinant Human Olfactory receptor 52N4 (OR52N4) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 52N4, Olfactory receptor OR11-64

UniProt

Q8NGI2

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTLNKTDLIPASFILNGVPGLEDTQLWISFPFCSMYVVAMVGNCGLLYLIHYEDALHKP MYYFLAMLSFTDLVMCSSTIPKALCIFWFHLKDIGFDECLVQMFFTHTFTGMESGVLMLM ALDRYVAICYPLRYSTILTNPVIAKVGTATFLRGVLLIIPFTFLTKLLPYCRGNILPHTY CDHMSVAKLSCGNVKVNAIYGLMVALLIWGFDILCITNSYTMILRAVVSLSSADARQKAF NTCTAHICAIVFSYTPAFFSFFSHRFGEHIIPPSCHIIVANIYLLLPPTMNPIVYGVKTK QIRDCVIRILSGSKDTKSYSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal CD45RA (Leucocyte Marker) Antibody - Without BSA and Azide, Clone: PTPRC/818
AMM01245G 0.1mg

Monoclonal CD45RA (Leucocyte Marker) Antibody - Without BSA and Azide, Clone: PTPRC/818

Sign In for Pricing
View Details
ZNF3 Antibody
orb422650-01 50 µg

ZNF3 Antibody

Sign In for Pricing
View Details
ZNF3 Antibody
orb422650-02 100 µg

ZNF3 Antibody

Sign In for Pricing
View Details
Monoclonal SHP-2 Antibody Phospho (pY542), Clone: EP508(2)Y
APR13314G 0.1ml

Monoclonal SHP-2 Antibody Phospho (pY542), Clone: EP508(2)Y

Sign In for Pricing
View Details
CrnA Recombinant Protein
OPCA01943-1MG 1 mg

CrnA Recombinant Protein

Sign In for Pricing
View Details
Vps50 (NM_001167750) Mouse Tagged Lenti ORF Clone
MR224374L3 10 µg

Vps50 (NM_001167750) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details