Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52N2 (OR52N2)

This Recombinant Human Olfactory receptor 52N2 (OR52N2) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 52N2, Olfactory receptor OR11-57

UniProt

Q8NGI0

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80��C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDNSSSLTPGFFILNGVPGLEATHIWISLPFCFMYIIAVVGNCGLICLISHEEALHRP MYYFLALLSFTDVTLCTTMVPNMLCIFWFNLKEIDFNACLAQMFFVHMLTGMESGVLMLM ALDRYVAICYPLRYATILTNPVIAKAGLATFLRNVMLIIPFTLLTKRLPYCRGNFIPHTY CDHMSVAKVSCGNFKVNAIYGLMVALLIGVFDICCISVSYTMILQAVMSLSSADARHKAF STCTSHMCSIVITYVAAFFTFFTHRFVGHNIPNHIHIIVANLYLLLPPTMNPIVYGVKTK QIQEGVIKFLLGDKVSFTYDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL31P28 3'UTR Lenti-reporter-Luc Vector
41368081 1.0 µg

RPL31P28 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
S1P1 Antibody
orb75066 100 µL

S1P1 Antibody

Sign In for Pricing
View Details
Human TRAF3IP2 siRNA
abx937908-01 15 nmol

Human TRAF3IP2 siRNA

Sign In for Pricing
View Details
Human TRAF3IP2 siRNA
abx937908-02 30 nmol

Human TRAF3IP2 siRNA

Sign In for Pricing
View Details
Fam123b siRNA Oligos set (Rat)
19743176 3x 5 nmol

Fam123b siRNA Oligos set (Rat)

Sign In for Pricing
View Details
CK19 antibody
10R-10359 100 ug

CK19 antibody

Sign In for Pricing
View Details