Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member D (Mrgprd)

This Recombinant Mouse Mas-related G-protein coupled receptor member D (Mrgprd) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member D, Beta-alanine receptor, G-protein coupled receptor TGR7

UniProt

Q91ZB8

Expression Region

1-321

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTLDSSPAPGLTISPTMDLVTWIYFSVTFLAMATCVGGMAGNSLVIWLLSCNGMQRSP FCVYVLNLAVADFLFLFCMASMLSLETGPLLIVNISAKIYEGMRRIKYFAYTAGLSLLTA ISTQRCLSVLFPIWYKCHRPRHLSSVVSGALWALAFLMNFLASFFCVQFWHPNKHQCFKV DIVFNSLILGIFMPVMILTSTILFIRVRKNSLMQRRRPRRLYVVILTSILVFLTCSLPLG INWFLLYWVDVKRDVRLLYSCVSRFSSSLSSSANPVIYFLVGSQKSHRLQESLGAVLGRA LRDEPEPEGRETPSTCTNDGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doxylamine Beta-D-Glucuronide (Mixture of diastereomers)
TRC-D562010-1MG 1 mg

Doxylamine Beta-D-Glucuronide (Mixture of diastereomers)

Sign In for Pricing
View Details
ReadiLink™ xtra Rapid iFluor® 594 Antibody Labeling Kit *BSA-Compatible*
1960-AAT 2 Labelings

ReadiLink™ xtra Rapid iFluor® 594 Antibody Labeling Kit *BSA-Compatible*

Sign In for Pricing
View Details
FTHL17 (NM_031894) Human Recombinant Protein
TP314888M 100 µg

FTHL17 (NM_031894) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Antibody
RC-5235-01 50 μL

Recombinant Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Antibody
RC-5235-02 100 µL

Recombinant Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Antibody
RC-5235-03 1 mL

Recombinant Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details