Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member D (Mrgprd)

This Recombinant Mouse Mas-related G-protein coupled receptor member D (Mrgprd) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member D, Beta-alanine receptor, G-protein coupled receptor TGR7

UniProt

Q91ZB8

Expression Region

1-321

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTLDSSPAPGLTISPTMDLVTWIYFSVTFLAMATCVGGMAGNSLVIWLLSCNGMQRSP FCVYVLNLAVADFLFLFCMASMLSLETGPLLIVNISAKIYEGMRRIKYFAYTAGLSLLTA ISTQRCLSVLFPIWYKCHRPRHLSSVVSGALWALAFLMNFLASFFCVQFWHPNKHQCFKV DIVFNSLILGIFMPVMILTSTILFIRVRKNSLMQRRRPRRLYVVILTSILVFLTCSLPLG INWFLLYWVDVKRDVRLLYSCVSRFSSSLSSSANPVIYFLVGSQKSHRLQESLGAVLGRA LRDEPEPEGRETPSTCTNDGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PCDH1 activation kit by CRISPRa
GA103408 1 Kit

Human PCDH1 activation kit by CRISPRa

Sign In for Pricing
View Details
Bis(2,3-dibromopropyl) Phosphate
TRC-B426235-25MG 25 mg

Bis(2,3-dibromopropyl) Phosphate

Sign In for Pricing
View Details
Laminin (A5), 0.2mg/mL
BNUB0308-100 1x 100 µL

Laminin (A5), 0.2mg/mL

Sign In for Pricing
View Details
Glucose 6 phosphate isomerase (GPI) (NM_001184722) Human Over-expression Lysate
LC433292 20 µg

Glucose 6 phosphate isomerase (GPI) (NM_001184722) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM208 antibody
FNab08770 100 µg

TMEM208 antibody

Sign In for Pricing
View Details
ERCC8 Human Gene Knockout Kit (CRISPR)
KN203124 1 Kit

ERCC8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details