Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 52P1 (OR52P1P)

This Recombinant Human Putative olfactory receptor 52P1 (OR52P1P) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Putative olfactory receptor 52P1

UniProt

Q8NH57

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESPNHTDVDPSVFFLLGIPGLEQFHLWLSLPVCGLGTATIVGNITILVVVATEPVLHKP VYLFLCMLSTIDLAASVSTVPKLLAIFWCGAGHISASACLAQMFFIHAFCMMESTVLLAM AFDRYVAICHPLRYATILTDTIIAHIGVAAVVRGSLLMLPCPFLIGRLNFCQSHVILHTY CEHMAVVKLACGDTRPNRVYGLTAALLVIGVDLFCIGLSYALSAQAVLRLSSHEARSKAL GTCGSHVCVILISYTPALFSFFTHRFGHHVPVHIHILLANVYLLLPPALNPVVYGVKTKQ IRKRVVRVFQSGQGMGIKASE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995E-01 50 Tests

APC Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
APC Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995E-02 100 Tests

APC Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
APC Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995E-03 2x 100 Tests

APC Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS623448 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
rac trans-Metconazole-d6
TRC-M225798-1MG 1 mg

rac trans-Metconazole-d6

Sign In for Pricing
View Details
DLL3 Human Gene Knockout Kit (CRISPR)
KN200005BN 1 Kit

DLL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details