Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 52P1 (OR52P1P)

This Recombinant Human Putative olfactory receptor 52P1 (OR52P1P) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Putative olfactory receptor 52P1

UniProt

Q8NH57

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESPNHTDVDPSVFFLLGIPGLEQFHLWLSLPVCGLGTATIVGNITILVVVATEPVLHKP VYLFLCMLSTIDLAASVSTVPKLLAIFWCGAGHISASACLAQMFFIHAFCMMESTVLLAM AFDRYVAICHPLRYATILTDTIIAHIGVAAVVRGSLLMLPCPFLIGRLNFCQSHVILHTY CEHMAVVKLACGDTRPNRVYGLTAALLVIGVDLFCIGLSYALSAQAVLRLSSHEARSKAL GTCGSHVCVILISYTPALFSFFTHRFGHHVPVHIHILLANVYLLLPPALNPVVYGVKTKQ IRKRVVRVFQSGQGMGIKASE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL
BNC880788-100 1x 100 µL

MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human C1orf77 (CHTOP) activation kit by CRISPRa
GA108750 1 Kit

Human C1orf77 (CHTOP) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS622328 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7F10]
CF806918 100 µg

Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7F10]

Sign In for Pricing
View Details
2-Vinylpyridine (stabilized with 0.1% 4-tert-butylcatechol)
TRC-V487495-1G 1 g

2-Vinylpyridine (stabilized with 0.1% 4-tert-butylcatechol)

Sign In for Pricing
View Details
IRF3 (NM_001571) Human Recombinant Protein
TP309951L 1 mg

IRF3 (NM_001571) Human Recombinant Protein

Sign In for Pricing
View Details