Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51V1 (OR51V1)

This Recombinant Human Olfactory receptor 51V1 (OR51V1) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 51V1, Odorant receptor HOR3'beta1, Olfactory receptor 51A12, Olfactory receptor OR11-36

UniProt

Q9H2C8

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLSSRMITSVSPSTSTNSSFLLTGFSGMEQQYPWLSIPFSSIYAMVLLGNCMVLHVIWT EPSLHQPMFYFLSMLALTDLCMGLSTVYTVLGILWGIIREISLDSCIAQSYFIHGLSFME SSVLLTMAFDRYIAICNPLRYSSILTNSRIIKIGLTIIGRSFFFITPPIICLKFFNYCHF HILSHSFCLHQDLLRLACSDIRFNSYYALMLVICILLLDAILILFSYILILKSVLAVASQ EERHKLFQTCISHICAVLVFYIPIISLTMVHRFGKHLSPVAHVLIGNIYILFPPLMNPII YSVKTQQIHTRMLRLFSLKRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nephronophthisis (NPHP1) (NM_001128179) Human Over-expression Lysate
LC426916 20 µg

Nephronophthisis (NPHP1) (NM_001128179) Human Over-expression Lysate

Sign In for Pricing
View Details
NPTXR Antibody
OC-778-01 50 μL

NPTXR Antibody

Sign In for Pricing
View Details
NPTXR Antibody
OC-778-02 100 µL

NPTXR Antibody

Sign In for Pricing
View Details
NPTXR Antibody
OC-778-03 1 mL

NPTXR Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS802878 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Tissue Total RNA, Uterus
CR560048 5 µg

Tissue Total RNA, Uterus

Sign In for Pricing
View Details