Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 3A3 (OR3A3)

This Recombinant Human Olfactory receptor 3A3 (OR3A3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 3A3, Olfactory receptor 17-201, OR17-201, Olfactory receptor 3A6, Olfactory receptor 3A7, Olfactory receptor 3A8, Olfactory receptor OR17-22

UniProt

P47888

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLV EPKLHAPMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMD CFLLTAMAYDRLLAICQPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGP NEVNHFYCDLPQLFQLSCSSTQLNELLLFVAAAFMAVAPLVFISVSYAHVVAAVLQIRSA EGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYS LRNTDVQGALCQLLVGKRSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose b-O-BSA Colloidal Gold Conjugate, 1mL 10nm
CCG-1001-10 1 mL

Glucose b-O-BSA Colloidal Gold Conjugate, 1mL 10nm

Sign In for Pricing
View Details
Adipic Acid
TRC-A291590-25G 25 g

Adipic Acid

Sign In for Pricing
View Details
JPT1 Rabbit Polyclonal Antibody
TA366120 100 µL

JPT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF568 conjugate, 0.1mg/mL
BNC682831-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdca5 Mouse Gene Knockout Kit (CRISPR)
KN502992 1 Kit

Cdca5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human RNF17 activation kit by CRISPRa
GA111147 1 Kit

Human RNF17 activation kit by CRISPRa

Sign In for Pricing
View Details