Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 3A3 (OR3A3)

This Recombinant Human Olfactory receptor 3A3 (OR3A3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 3A3, Olfactory receptor 17-201, OR17-201, Olfactory receptor 3A6, Olfactory receptor 3A7, Olfactory receptor 3A8, Olfactory receptor OR17-22

UniProt

P47888

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLV EPKLHAPMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMD CFLLTAMAYDRLLAICQPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGP NEVNHFYCDLPQLFQLSCSSTQLNELLLFVAAAFMAVAPLVFISVSYAHVVAAVLQIRSA EGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYS LRNTDVQGALCQLLVGKRSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON1 Antibody
KC-23568-01 50 μL

PON1 Antibody

Sign In for Pricing
View Details
PON1 Antibody
KC-23568-02 100 µL

PON1 Antibody

Sign In for Pricing
View Details
PON1 Antibody
KC-23568-03 1 mL

PON1 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS701095 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
SLC2A13 Rabbit Polyclonal Antibody
TA381631 100 µL

SLC2A13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR8U8 Human Gene Knockout Kit (CRISPR)
KN422839 1 Kit

OR8U8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details