Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 3A3 (OR3A3)

This Recombinant Human Olfactory receptor 3A3 (OR3A3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 3A3, Olfactory receptor 17-201, OR17-201, Olfactory receptor 3A6, Olfactory receptor 3A7, Olfactory receptor 3A8, Olfactory receptor OR17-22

UniProt

P47888

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLV EPKLHAPMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMD CFLLTAMAYDRLLAICQPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGP NEVNHFYCDLPQLFQLSCSSTQLNELLLFVAAAFMAVAPLVFISVSYAHVVAAVLQIRSA EGRKKAFSTCGSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGVGVFMTVINPMLNPLIYS LRNTDVQGALCQLLVGKRSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTF2 Rabbit Polyclonal Antibody
TA371148 100 µL

TTF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery
CS626570 5x 5 µm

Frozen Tissue Sections, Artery

Sign In for Pricing
View Details
IRAK2 Human Gene Knockout Kit (CRISPR)
KN418437 1 Kit

IRAK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF568 conjugate, 0.1mg/mL
BNC682217-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTC16 (N-term) Rabbit Polyclonal Antibody
AP54393PU-N 400 µL

TTC16 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caveolin 3 (CAV3) Human qPCR Primer Pair (NM_033337)
HP233547 200 Reactions

Caveolin 3 (CAV3) Human qPCR Primer Pair (NM_033337)

Sign In for Pricing
View Details