Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 3A2 (OR3A2)

This Recombinant Human Olfactory receptor 3A2 (OR3A2) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 3A2, Olfactory receptor 17-228, OR17-228, Olfactory receptor OR17-14

UniProt

P47893

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLQKLMEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLLLFAYLVTTGGNLSILAAVLV EPKLHAPMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMD CFLLTAMAYDRLLAICQPLTYSTRMSQTVQRMLVAASLACAFTNALTHTVAMSTLNFCGP NEVNHFYCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPLVLIITAYSHVAAAVLRIRSV EGRKKAFSTCGSHLTVVCLFFGRGIFNYMRLGSEEASDKDKGVGVFNTVINPMLNPLIYS LRNPDVQGALWQIFLGRRSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3×FLAG-Puro Plasmid
PVT62858 2 µg

pLV3×FLAG-Puro Plasmid

Sign In for Pricing
View Details
GIP (1-30) amide, porcine
MBS5798450 Inquire

GIP (1-30) amide, porcine

Sign In for Pricing
View Details
Zfp866 Mouse siRNA Oligo Duplex (Locus ID 330788)
SR416571 1 Kit

Zfp866 Mouse siRNA Oligo Duplex (Locus ID 330788)

Sign In for Pricing
View Details
Nedd1 ORF Vector (Mouse) (pORF)
ORF051199 1.0 µg DNA

Nedd1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Dostarlimab (Anti-PDCD1 / PD-1 / CD279)
C00594-1mg 1 mg

Dostarlimab (Anti-PDCD1 / PD-1 / CD279)

Sign In for Pricing
View Details
Recombinant Aeromonas Salmonicida rplU Protein (aa 1-103)
VAng-Lsx1137-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Salmonicida rplU Protein (aa 1-103)

Sign In for Pricing
View Details