Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5K3 (OR5K3)

This Recombinant Human Olfactory receptor 5K3 (OR5K3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 5K3

UniProt

A6NET4

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKENHSLIAEFILTGFTYHPKLKTVLFVVFFAIYLITMVGNIGLVALIYIEQRLHTPMY IFLGNLVLMDSCCSSAITPKMLENFFSEDKRITLYECMAQFYFLCLAETTDCFLLAAMAY DCYVAICNPLQYHTMMSKTLCIQMTAGAYLAGNLHPMIEVEFLLRLTFCGSHQINHFFCD VLPLYRLSCINPYINELVLFILAGSIQIFTIVLVSYFYILFTIFTMKSKEGRGKALSTCA SHFLSVSIFCDSLLFMYARPGAVNEGDKDIPVAIFYTLVIPLLNPFIYSLRNKEVINIMK KIMKKRKFCHILKQMSSPLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEPP shRNA Plasmid (h)
sc-90781-SH 20 µg

DEPP shRNA Plasmid (h)

Sign In for Pricing
View Details
Paper filter disc diam.125mm Gen Use qualitative 91 34-42um retention GVS 100 pc
FP125DME91QALC01 100 Pieces/Case:100 Pieces/ PACKS:1 PACKS/CASE

Paper filter disc diam.125mm Gen Use qualitative 91 34-42um retention GVS 100 pc

Sign In for Pricing
View Details
Recombinant Cynomolgus Monkey KCNE1 Protein, His (Fc)-Avi-tagged
KCNE1-382C 50 µg

Recombinant Cynomolgus Monkey KCNE1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
NLRP3 Antibody
E51A04260 100 µL

NLRP3 Antibody

Sign In for Pricing
View Details
PDX1 (Ab-61) Antibody
MBS859140-01 0.1 mg

PDX1 (Ab-61) Antibody

Sign In for Pricing
View Details
PDX1 (Ab-61) Antibody
MBS859140-02 0.1 mL (AF635)

PDX1 (Ab-61) Antibody

Sign In for Pricing
View Details