Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5K3 (OR5K3)

This Recombinant Human Olfactory receptor 5K3 (OR5K3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 5K3

UniProt

A6NET4

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKENHSLIAEFILTGFTYHPKLKTVLFVVFFAIYLITMVGNIGLVALIYIEQRLHTPMY IFLGNLVLMDSCCSSAITPKMLENFFSEDKRITLYECMAQFYFLCLAETTDCFLLAAMAY DCYVAICNPLQYHTMMSKTLCIQMTAGAYLAGNLHPMIEVEFLLRLTFCGSHQINHFFCD VLPLYRLSCINPYINELVLFILAGSIQIFTIVLVSYFYILFTIFTMKSKEGRGKALSTCA SHFLSVSIFCDSLLFMYARPGAVNEGDKDIPVAIFYTLVIPLLNPFIYSLRNKEVINIMK KIMKKRKFCHILKQMSSPLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPM2A Antibody
A20736-100UG 100 µg

EPM2A Antibody

Sign In for Pricing
View Details
GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45) (MaxLight 405) discontinued
127093-ML405 100 µL

GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45) (MaxLight 405) discontinued

Sign In for Pricing
View Details
A-glucopyranosyl (1 inverted exclamation marku3)
orb2564112 5 mg

A-glucopyranosyl (1 inverted exclamation marku3)

Sign In for Pricing
View Details
Canine Prostaglandin H2 (PGH2) ELISA Kit
MBS2605272-01 48 Well

Canine Prostaglandin H2 (PGH2) ELISA Kit

Sign In for Pricing
View Details
Canine Prostaglandin H2 (PGH2) ELISA Kit
MBS2605272-02 96 Well

Canine Prostaglandin H2 (PGH2) ELISA Kit

Sign In for Pricing
View Details
Canine Prostaglandin H2 (PGH2) ELISA Kit
MBS2605272-03 5x 96 Well

Canine Prostaglandin H2 (PGH2) ELISA Kit

Sign In for Pricing
View Details