Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5K3 (OR5K3)

This Recombinant Human Olfactory receptor 5K3 (OR5K3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Olfactory receptor 5K3

UniProt

A6NET4

Expression Region

1-321

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKENHSLIAEFILTGFTYHPKLKTVLFVVFFAIYLITMVGNIGLVALIYIEQRLHTPMY IFLGNLVLMDSCCSSAITPKMLENFFSEDKRITLYECMAQFYFLCLAETTDCFLLAAMAY DCYVAICNPLQYHTMMSKTLCIQMTAGAYLAGNLHPMIEVEFLLRLTFCGSHQINHFFCD VLPLYRLSCINPYINELVLFILAGSIQIFTIVLVSYFYILFTIFTMKSKEGRGKALSTCA SHFLSVSIFCDSLLFMYARPGAVNEGDKDIPVAIFYTLVIPLLNPFIYSLRNKEVINIMK KIMKKRKFCHILKQMSSPLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-methyl-2,4-dioxo-1,2,3,4-tetrahydropyrido[2,3-d]pyrimidine-6-carboxylic acid
sc-334101A 1 g

1-methyl-2,4-dioxo-1,2,3,4-tetrahydropyrido[2,3-d]pyrimidine-6-carboxylic acid

Sign In for Pricing
View Details
Recombinant Human MICB Protein (His Tag)(Active)
MBS2571271-01 0.02 mg

Recombinant Human MICB Protein (His Tag)(Active)

Sign In for Pricing
View Details
Recombinant Human MICB Protein (His Tag)(Active)
MBS2571271-02 0.1 mg

Recombinant Human MICB Protein (His Tag)(Active)

Sign In for Pricing
View Details
Recombinant Human MICB Protein (His Tag)(Active)
MBS2571271-03 5x 0.1 mg

Recombinant Human MICB Protein (His Tag)(Active)

Sign In for Pricing
View Details
CCR4 Rabbit Polyclonal (C-Terminus) Antibody
TA317653 50 µg

CCR4 Rabbit Polyclonal (C-Terminus) Antibody

Sign In for Pricing
View Details
Connexin 32 (Cx32) (MaxLight 490)
MBS6470096-01 0.1 mL

Connexin 32 (Cx32) (MaxLight 490)

Sign In for Pricing
View Details