Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloranthus spicatus Cytochrome c biogenesis protein ccsA (ccsA)

This Recombinant Chloranthus spicatus Cytochrome c biogenesis protein ccsA (ccsA) spans the amino acid sequence from region 1-322.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccsA

UniProt

A6MMH8

Expression Region

1-322

Origin

Chloranthus spicatus (Chulantree) (Nigrina spicata)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIFATLEHILTHICFSIILIVITIHLITLLVHEIGLYNLSEKGMIATFFCITGLLVSRWI YSGHFPLSDLYESLIFLSWSFAIIHMVPKIRNHPNSLSTITAPSTIFTQGFTTSGLLTKM HQSTILVPALQSKWLMMHVSMMLLSYAALLCGSLLSIALLVITFRKNIDILGKSNHLFIG SFSFGKTQYLNEKRSLLHLQKASFLSFRNYHRYQLTHRLDYWSYRVISLGFTFLTIGILS GAVWANEAWGSYWNWDPKETWAFITWTIFAIYSHTRTNKSLQGANSAIVASMGFLIIWIC YFGVNLLGIGLHSYGSFTLTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-100 1x 100 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-100 1x 100 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details