Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactuca sativa Cytochrome c biogenesis protein ccsA (ccsA)

This Recombinant Lactuca sativa Cytochrome c biogenesis protein ccsA (ccsA) spans the amino acid sequence from region 1-322.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccsA

UniProt

Q332S8

Expression Region

1-322

Origin

Lactuca sativa (Garden lettuce)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIFSTLEHIFTHISFSIVSIVIIIHLITLLGNEIIKPYDSSEKGMIVTFLCLTGLLITRW IYSGHFPLSDLYESLIFLSWSFSLIHIVPYFKIRKNYLTEITASSTIFTQGFATSGLLTE IRKPTILVPALQSEWLIMHVSMMILSYAALLCGSLLSVALLVITFRKIFYSYKSNNFLKL NESFSFGEIQYKNERNNILKKNYFLSAKNYYKAQLIQQLDYWSYRVISLGFIFLTIGILS GAVWANEAWGSYWSWDPKETWAFITWIVFAIYLHIRTNKNFQGANSAIVATLGFLIIWIC YFGVNLLGIGLHSYGSFTLTSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
BNC940994-100 1x 100 µL

TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-500 1x 500 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details