Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 11L1 (OR11L1)

This Recombinant Human Olfactory receptor 11L1 (OR11L1) spans the amino acid sequence from region 1-322.

Product Specifications

Product Name Alternative

Olfactory receptor 11L1

UniProt

Q8NGX0

Expression Region

1-322

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPQNTSTVTNFQLLGFQNLLEWQALLFVIFLLIYCLTIIGNVVIITVVSQGLRLHSPMY MFLQHLSFLEVWYTSTTVPLLLANLLSWGQAISFSACMAQLYFFVFLGATECFLLAFMAY DRYLAICSPLRYPFLMHRGLCARLVVVSWCTGVSTGFLPSLMISRLDFCGRNQINHFFCD LPPLMQLSCSRVYITEVTIFILSIAVLCICFFLTLGPYVFIVSSILRIPSTSGRRKTFST CGSHLAVVTLYYGTMISMYVCPSPHLLPEINKIISVFYTVVTPLLNPVIYSLRNKDFKEA VRKVMRRKCGILWSTSKRKFLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK343
A3449-25 25 mg

GSK343

Sign In for Pricing
View Details
SNIP1 ELISA Kit (Human) (OKCA01521)
OKCA01521 96 Well

SNIP1 ELISA Kit (Human) (OKCA01521)

Sign In for Pricing
View Details
Mouse Paqr6 / Progestin and adipoQ receptor family member 6 Recombinant Protein
R8084m 1 Each

Mouse Paqr6 / Progestin and adipoQ receptor family member 6 Recombinant Protein

Sign In for Pricing
View Details
Estrogen Receptor alpha Antibody, AbBy Fluor™ 750 Conjugated
bs-2098R-BF750-01 20 µL

Estrogen Receptor alpha Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Estrogen Receptor alpha Antibody, AbBy Fluor™ 750 Conjugated
bs-2098R-BF750-02 100 µL

Estrogen Receptor alpha Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Polyclonal ZMYND8 / RACK7 Antibody (aa581-630)
AMM08558G 0.05ml

Polyclonal ZMYND8 / RACK7 Antibody (aa581-630)

Sign In for Pricing
View Details